PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G056000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 442aa    MW: 49484 Da    PI: 5.6945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G056000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-18127173148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g WT+ Ed +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  Sobic.001G056000.1.p 127 KGQWTPAEDRKLVKLVEQFGLRKWSYIAQLLP-GRVGKQCRERWHNHL 173
                           799*****************************.*************97 PP

2Myb_DNA-binding52.31.3e-16181221345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            W+ eEd  l++a+k+ G++ W+ Ia++++ gRt++++k++w+
  Sobic.001G056000.1.p 181 IWSDEEDMVLIQAHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 221
                           6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.003122177IPR017930Myb domain
SMARTSM007175.2E-14126175IPR001005SANT/Myb domain
SuperFamilySSF466891.29E-30126220IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29128180IPR009057Homeodomain-like
CDDcd001672.12E-14130173No hitNo description
PfamPF139211.3E-17130187No hitNo description
SMARTSM007172.5E-16178226IPR001005SANT/Myb domain
PROSITE profilePS5129419.544178228IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-21181226IPR009057Homeodomain-like
CDDcd001671.32E-13182224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MDFSCFQPHT GISSYLPFDS YMQQNGRYEL HPVDHHPFEV IGDCTSATFN DLGHRFFVER  60
EIKKPTFDHA SSVGQRVGSQ LPLLTPKTEV SHLMDGGLGS YKAYGMNGRF LPRKKTSLKK  120
ANVVVVKGQW TPAEDRKLVK LVEQFGLRKW SYIAQLLPGR VGKQCRERWH NHLRPNIKKD  180
IWSDEEDMVL IQAHKEVGNK WAEIAKRLPG RTENSIKNHW NATKRRQFAR RRSRSSKGPK  240
SGTLLQNYIK GLGIAGPSNK TAAAPLPEPT LSPSSLEAPG AKSAKTDEIT LEVEHISMSS  300
NIPDSQGILL LPSIHEYNNC SESQSCEDLL APICDEFSVE MCDGLFDTNE DADAFQVYAM  360
DDDIDMNYIF NYIEHAAIKV DPEIDMEMMM MMMWDGDDGG LLGCDADPAG PAHVETVHVK  420
EEMDLIEMVA ATQNCGEAEN H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-461242271104C-Myb DNA-Binding Domain
1msf_C9e-461242271104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432524e-71AC243252.2 Panicum virgatum clone PV_ABa094-H10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463735.10.0hypothetical protein SORBIDRAFT_01g005100
TrEMBLC5WX620.0C5WX62_SORBI; Putative uncharacterized protein Sb01g005100
STRINGSb01g005100.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-58myb domain protein 98